<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14864
Description |
Uncharacterized protein |
Sequence | RVARPTAYRLYLELLRRHGFKLCFQMKAANSNKIRQLIDDNLNLSKIFGFSACEPGVFIVELVLCILWQLVDTALDDESLLELTPEKKAQWPTRPQDISAFEVSFPEQKPEKIEKLQRMNSVITIELIGHLLHNKVITRILSLARENMQTQWGLFTYRLQLLVANSSTLQASTMSLQAFQQLILDDHNVHGENKHSLHKKFHPMVASNPLSSPNGHCLGGSYSALWIPIDMYLEDCLDGSIAATNSIEILSGLVKALQAVNRSSWHDAFMALWIASVRLVQRVSLHSSFCLIIKQPFIF |
Length | 299 |
Position | Tail |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.035 |
Instability index | 48.48 |
Isoelectric point | 8.23 |
Molecular weight | 33950.06 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14864
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.86| 17| 18| 217| 233| 1
---------------------------------------------------------------------------
217- 233 (34.28/19.92) CLGGSYSAL.WIPIDMYL
236- 253 (23.58/12.00) CLDGSIAATnSIEILSGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.56| 10| 19| 260| 269| 2
---------------------------------------------------------------------------
260- 269 (20.51/14.68) VNRSSWHDAF
280- 289 (18.06/12.12) VQRVSLHSSF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.83| 14| 19| 77| 90| 3
---------------------------------------------------------------------------
77- 90 (23.26/16.62) DESLLELT.PEKKAQ
97- 111 (20.57/13.92) DISAFEVSfPEQKPE
---------------------------------------------------------------------------
|