<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14846

Description Uncharacterized protein
SequenceMQFLEDFVNCNEVASFLDCIRLTTGPLLSLGGAIRPSKMPTVSGSAQKQNNVLLANGSSPTTVHINSHDAQTSSMLSAVGRTGPGLVPSSLMPFDVSVVLRGPYWIRIIYRNKFSVDMRCFAGDQVWLQPATPPKGGPSVGGSLPCPQFRPFIMEHVAQGLNTLEPSFLSARHTSPNTSSGSQHVVTAANRSSGGPPGEIKLTSGVGCQIAASVSRASNAILPSGFASRTDGAPAHLSLDTNLPVHMKGELNTAFIGLGDDGGYGGGWVPHAALKKVLRGILKYLGVLWLFAQFRDILKDILGSVLKDNEGALLNLDQEQPALRFFVG
Length328
PositionTail
OrganismHordeum vulgare subsp. vulgare (Domesticated barley)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
Aromaticity0.07
Grand average of hydropathy0.021
Instability index40.44
Isoelectric point8.84
Molecular weight34731.34
Publications
PubMed=23075845

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14846
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     190.01|      54|      55|      84|     138|       1
---------------------------------------------------------------------------
   85-  138 (99.93/60.12)	GLVP.SSLMPFDVSVVLRGPYWIRIIYRNKFSVDMRCFAGDQVWLQPATPPKGGP
  142-  196 (90.08/49.09)	GSLPcPQFRPFIMEHVAQGLNTLEPSFLSARHTSPNTSSGSQHVVTAANRSSGGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.09|      15|      24|     203|     223|       3
---------------------------------------------------------------------------
  203-  223 (15.11/26.97)	TSGVgcqiAASVSRASNaiLP
  230-  244 (27.98/18.30)	TDGA....PAHLSLDTN..LP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.69|      17|      22|     268|     288|       4
---------------------------------------------------------------------------
  265-  282 (26.15/21.77)	GGGWVpHAALKKVLRGIL
  286-  302 (30.54/12.28)	GVLWL.FAQFRDILKDIL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14846 with Med14 domain of Kingdom Viridiplantae
Unable to open file!