<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14844

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMHEGLQHARAPIFDVSSAIEVIHTGSYRRLPKSVEEIGTQNTLFQDERMPTLKKLSTLVRAKLLETLVPKEISEVLVADGIANVQVDGEFKVLLTLGYRGHFSLWRILHIELLVGEKTGPIKLEETRRYVLGDDIERRMAVADNPFTILYTILHELCISFVMDTVIRQTNVLRQGRWKEAIKSELVSDSHRSAGQGGNNAPTQLGQDGELDSSGLKIPGLKVNYWLDERNSGSAESDSSPFIKVEALQDMQIKCQHSSFVLDPLTDKEADLSLDLSCIDVEALILKAIACNIHTRLLEIQRELKKNTQISRSPSDVVLKQKEVHMDVLQKRVDRRGFENCCTNEVLQVRAYGKSYIHLGINIRSGGFLLQSPKNILPPSAVLDSEEALNKRSITPPEVFVSLKTRSILHLLAATGRFLGLKVYSECQITLKIPKSILYGSDFMVMGFPWGTNVYYLLMQLDDNLMPVFYLLEVHTDGEDRSNIDTTTDAKEVVRFNRIDIGQMQLGEDECSANLLDVEKLQVLQSKLNQQSMEDRSPRQSGIDESLPLKHSFSSVVNTVLGYEQDSPSKENRLPYSSPSIHLSPQEVGHQGDSSRAGPPELDDDLLRSNTDTAKLASGVTLDSYLLSNSKSAFSTDTTSSDPAGLENISTLRSEVPSRKRYLSEFLLNIPSLQRSIIDGGPRKRRKLLEDASNVQSRTTLTYGTILKEGNCCITENIYASVLLQVIKHCSLCIKYAQLTTQMNSLDIPYVEEVGLGTPSSSLWLRLPFAQDGSWKHTCLRLGKAGSMSWSVRINDPYYGALWKLHGGSNTTEWGSVRIANTCEMDSHIYFDYDGIILTYNSVEADSIQRLVLELRRLLNARVFACGMRRLIRVNVDEKLVENQVARRAKLHSARKGFRNRLSDQTAKTFRINAVGLMNLWFSYGANAMTMVHFVVEWEADKVGCTMRISPDHLWPHTKFLEDFVNCNEVASFLDCIRLTTGPLLSLGGAIRPSKMPTVSGSAQKQNNVLLANGSSPTTVHINSHDAQTSSMLSAVGRTGPGLVPSSLMPFDVSVVLRGPYWIRIIYRNKFSVDMRCFAGDQVWLQPATPPKGGPSVGGSLPCPQFRPFIMEHVAQGLNTLEPSFLSARHTSPNTSSGSQHVVTAANRSSGGPPGEIKLTSGVGCQIAASVSRASNAILPSGFASRTDGAPAHLSLDTNLPVHMKGELNTAFIGLGDDGGYGGGWVPHAALKKVLRGILKYLGVLWLFAQFRDILKDILGSVLKDNEGALLNLDQEQPALRFFVGGYVFAVSVHRVQLHLQVLNVKRFHHQQQQQQVPQSSAQGELTPSEIHEICDYFSRCVACEPYDASRIASFIMLLTLPILVIQEFVKLIAWNKSLSEAHGDIATAERARAELCLEKHPRSVSDDYTEPSLLSKSNIQHDRANNSVDFTLTFVLDHNLTPHVRTSGGAAWLPFCVSLRLRYTFGDTSHVTYLAMDGSHGGRSCWLQHVDWERCKQSVVKAVNTVNGSPIAGDTAQGRLQMVTEMVQKQLQLCLVYLRDGSLSAGSTRP
Length1550
PositionTail
OrganismHordeum vulgare subsp. vulgare (Domesticated barley)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
Aromaticity0.07
Grand average of hydropathy-0.200
Instability index50.05
Isoelectric point7.03
Molecular weight171786.06
Publications
PubMed=23075845

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14844
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     279.55|     105|     258|    1125|    1239|       1
---------------------------------------------------------------------------
  577-  645 (71.50/36.25)	SPSIHLSPQEVGHQGDSSRAGPP.ELDddlLRSNTDtAKLASGVTLDSYLLSNSKSAFSTDttsSDPAGL.....................................................................
 1131- 1239 (171.69/134.84)	SPNTSSGSQHVVTAANRSSGGPPgEIK...LTSGVG.CQIAASVSRASNAILPSGFASRTD...GAPAHLsLDTNLPVHMKGELNTA.....................FIGLgdDGGYGG..GWVPHAALKKVLRGILK
 1436- 1501 (36.37/14.64)	.......................................................................LDHNLTPHVRTSGGAAwlpfcvslrlrytfgdtshvtYLAM..DGSHGGrsCWLQHVDWERCKQSVVK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     102.12|      29|     151|     511|     540|       6
---------------------------------------------------------------------------
  238-  259 (31.82/15.38)	SSPFIKVEALQDMQIK.CQHSSF.......
  511-  539 (47.48/28.62)	SANLLDVEKLQVLQSK.LNQQSMEDRSPRQ
 1299- 1319 (22.81/11.14)	.........LQVLNVKrFHHQQQQQQVPQS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14844 with Med14 domain of Kingdom Viridiplantae
Unable to open file!