<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14812
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | LKPIYKPQVRYAPSLPQKEYCLPKKTRKNSLLAGQSSSPSPYPSRRRRRRPAGSMDAMEEDTPPAPPLPPPPTTGAKQPPYKDPDDGRQRFLLELEFIQCLANPIYINYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPAPAPAPVPTPPPVPAAPSSLPTMSAVGASAMPPMQFIGTPGTNNPKNDMRNVMGGRKRKMG |
| Length | 260 |
| Position | Middle |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.775 |
| Instability index | 74.29 |
| Isoelectric point | 9.93 |
| Molecular weight | 29689.03 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14812
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.68| 26| 58| 91| 116| 4
---------------------------------------------------------------------------
91- 116 (47.55/32.48) FLLEL....EFIQCLANPIYINYLAQNRYF
147- 176 (42.13/28.01) FFLELlqnaNFRNAMAHPASKEVAHRQQYF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.19| 20| 151| 24| 43| 5
---------------------------------------------------------------------------
24- 43 (36.12/13.56) KKTRKNSL...LAGQSSSPSPYP
179- 201 (35.07/12.97) KNYRNNRLkhiLPRPPPEPTPAP
---------------------------------------------------------------------------
|