<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14774
| Description |
Uncharacterized protein |
| Sequence | MRKKRSGGGMDATVDELSAAYKEFVAAAVAVMEAREQSGGQKTAATDTALEAFKQRWELFRVSCDHAEELVESIRQRIGSECLVDEATGSSSSSSAPASVALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGPSAAGPGGGVSTPAAGAGGHHVHGGVESRFPEDGTQFAVEAVWCDLIFPMSGEVVVDDSG |
| Length | 195 |
| Position | Tail |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.102 |
| Instability index | 57.68 |
| Isoelectric point | 5.02 |
| Molecular weight | 20154.30 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14774
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.64| 17| 19| 16| 34| 1
---------------------------------------------------------------------------
10- 31 (16.68/14.37) MDAtvdELSAAYKefVAAAVAV
32- 49 (24.96/13.97) MEA..rEQSGGQK..TAATDTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.32| 18| 44| 89| 106| 2
---------------------------------------------------------------------------
89- 106 (29.39/15.17) GSSSSSSAPASVALAAPG
134- 151 (32.92/17.88) GGPSAAGPGGGVSTPAAG
---------------------------------------------------------------------------
|