<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14756
Description |
Uncharacterized protein |
Sequence | MLFLISLSWSDALQFSCPVLLFSIHTVVLHLLLVSHHFSCLTCMSIAVLLVMLSSKLLPEMEVEETTKREQLLSGITNLPVPLCLFLLVE |
Length | 90 |
Position | Head |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.07 |
Grand average of hydropathy | 1.092 |
Instability index | 54.82 |
Isoelectric point | 5.39 |
Molecular weight | 10097.14 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14756
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.76| 18| 21| 15| 35| 1
---------------------------------------------------------------------------
15- 35 (27.00/18.56) FSCpvlLFSIHTVVLHLLLVS
38- 55 (32.76/15.26) FSC...LTCMSIAVLLVMLSS
---------------------------------------------------------------------------
|