<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14752
Description |
Mediator of RNA polymerase II transcription subunit 1 |
Sequence | ESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMVRIVLLLNPGSISCLENLLYLPQVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNMKYYASPSDLLDDKTASPIILHENNVPRSLGMNASVTIEGTSTMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRTFVQKLQNCTGIPLFETQPTYVPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVNKITFQHPGRVPLILNIIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGVEEKRQNKPINFYLSSAVGFKL |
Length | 558 |
Position | Middle |
Organism | Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae>
Xerinae> Marmotini> Ictidomys.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.138 |
Instability index | 51.58 |
Isoelectric point | 8.16 |
Molecular weight | 62203.32 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14752
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 147.06| 45| 48| 141| 188| 1
---------------------------------------------------------------------------
141- 188 (70.75/59.83) KHLKGLVNlYNLP..GDNKLKTKMYLALQSLEQDLSKMAIMYWKatNAGP
191- 237 (76.31/53.18) KILHGSVG.YLTPrsGGHLMNMKYYASPSDLLDDKTASPIILHE..NNVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 173.38| 45| 51| 320| 370| 2
---------------------------------------------------------------------------
254- 323 (53.15/28.30) MYkLPIAPLIM......GSHPVDNKWT.PSF...SSitsansvDLPA...CF...FLKFPQPipvsrtfvqklqnctgiplfETQP
324- 376 (64.03/52.19) TY.VPLYELITqFelsKDPDPIPLNHN.MRF...YA.......ALPGQqhCY...FLNKDAP..................lpDGRS
377- 433 (56.21/30.31) LQ.GTLVNKIT.F...QHPGRVPLILNiIRHqvaYN.......TLIGS..CVkrtILKEDSP...............gllqfEVCP
---------------------------------------------------------------------------
|