<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14751

Description Mediator complex subunit 25
SequenceMVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPELGSLIKLFSYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGYTTESLVQQIGERGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQPPTDVSQDPRHMVLVRGLVLPVGGGSAPGPLQPKQPVPLPPAAPSGATLSAAPQQSLPPVPPQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPINPLQQAASGVGPPFSQAPAPPLPPGPPGAPKPPPASQPSLVSTVAPGPGLAPPAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGHPLQLRPPQPQPQGTVGASGATGQPQPQGTTQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQSLGQPQLGPPLLHPPPTQSWPTQLPPRAPLPAAKRKREGEGRVFREKWERDYFFVEVKSMPTCLICKKIMSVLKEYNLKRHYESRHSKSFDQYTEQTRDAILRFALETEE
Length763
PositionUnknown
OrganismIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae> Xerinae> Marmotini> Ictidomys.
Aromaticity0.06
Grand average of hydropathy-0.312
Instability index58.58
Isoelectric point9.34
Molecular weight81473.76
Publications









Function






Annotated function


GO - Cellular Component
nucleoplasm	GO:0005654	IEA:Ensembl

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14751
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.58|      16|      19|     341|     359|       4
---------------------------------------------------------------------------
  313-  328 (34.82/ 6.62)	SQAPAPPL.PPGPPGAP
  341-  357 (31.76/11.96)	TVAPGPGLaPPAQPGAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     117.03|      27|      30|     217|     243|       5
---------------------------------------------------------------------------
  198-  229 (37.71/ 8.36)	PLQPPTDVSQD.PRHmvlvrGLVLPVGGGSAPG
  230-  258 (41.98/10.15)	PLQPKQPVPLP.PAA...psGATLSAAPQQSLP
  551-  578 (37.34/ 8.20)	PLQLRPPQPQPqGTV.....GASGATGQPQPQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.68|      15|     264|     365|     381|       6
---------------------------------------------------------------------------
  365-  379 (26.83/ 7.74)	PGGVSGPSPAQLGAP
  420-  434 (22.85/10.14)	PCQVYVNHGENLKTE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.59|      15|      16|     609|     623|       8
---------------------------------------------------------------------------
  609-  623 (29.77/10.50)	P..GANPQLRSL.LLNPP
  625-  642 (22.82/ 6.39)	PqtGVPPPQASLhHLQPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.78|      14|      44|      48|      61|       9
---------------------------------------------------------------------------
   48-   61 (25.74/13.65)	IKLFSYGGTQYSLV
   93-  106 (27.04/14.68)	IKFMGGGGESCSLI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.17|      20|     427|      28|      47|      10
---------------------------------------------------------------------------
   28-   47 (37.89/26.35)	LGPYFEGLRK...HYLLPELGSL
  453-  475 (32.28/21.26)	LGPLFRNSRMvqfHFTNKDLESL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.13|      20|      36|     125|     147|      11
---------------------------------------------------------------------------
  125-  147 (29.46/28.54)	EQIGQtHRVCLLICNspPYLLPA
  163-  182 (34.68/20.19)	QQIGE.RGIHFSIVS..PRKLPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.99|      15|      26|     478|     492|      12
---------------------------------------------------------------------------
  478-  492 (29.20/20.48)	LYRIMGNGFAGCVHF
  506-  520 (26.78/18.18)	LYSSKKKIFMGLIPY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14751 with Med25 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GGSAPGPLQPKQPVPLPPAAPSGATLSAAPQQSLPPVPPQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPINPLQQAASGVGPPFSQAPAPPLPPGPPGAPKPPPASQPSLVSTVAPGPGLAPPAQPGAPSMAGTVAPGGVSGPSPAQLGAPALG
2) TNHKQVQQQKLEQQRGHPLQLRPPQPQPQGTVGASGATGQPQPQGTTQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQSLGQPQLGPPLLHPPPTQSWPTQLPPRAPLPAAKRKREGEG
224
534
382
694










Molecular Recognition Features






MoRF SequenceStartStop




NANANA