<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14750
| Description |
Cyclin dependent kinase 19 |
| Sequence | KDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDEPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPQQQNNTQTNGTTGGTAAGVGGAGAGLQHSQDSGLNQVPPNKKPRLGASGTNSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSAQYHPSHQAHRY |
| Length | 415 |
| Position | Kinase |
| Organism | Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae>
Xerinae> Marmotini> Ictidomys.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.767 |
| Instability index | 58.62 |
| Isoelectric point | 8.47 |
| Molecular weight | 46878.26 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14750
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 109.74| 22| 33| 324| 345| 1
---------------------------------------------------------------------------
300- 319 (34.45/13.99) QQAAAPPQAPP..QQQNNTQTN
324- 345 (37.47/15.75) GTAAGVGGAGAGLQHSQDSGLN
359- 379 (37.82/15.96) GTNSGGPVMPSDYQHSS.SRLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.35| 10| 17| 380| 389| 2
---------------------------------------------------------------------------
380- 389 (18.90/10.35) YQSSVQGSSQ
396- 405 (18.45/ 9.96) YSSSSQQSAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.65| 16| 17| 232| 247| 3
---------------------------------------------------------------------------
232- 247 (27.33/14.29) DPTKRITSEQALQDPY
251- 266 (29.32/15.81) DPLPTLDVFAGCQIPY
---------------------------------------------------------------------------
|