<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14744
| Description |
Uncharacterized protein |
| Sequence | MAAPLGGMFSGQPPGPPHPPPGLPGQASLLQAAPGAPRTSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGRLRTKE |
| Length | 82 |
| Position | Head |
| Organism | Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae>
Xerinae> Marmotini> Ictidomys.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.417 |
| Instability index | 60.43 |
| Isoelectric point | 4.74 |
| Molecular weight | 8508.37 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14744
No repeats found
No repeats found
|