<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14743
Description |
Uncharacterized protein |
Sequence | MAAPLGGMFSGHPPASLLQAAPGAPRTSSSTLVDKLESSFEACFASLVSQDYVNGTDQEENRTGVDQCIQKFLDILSVQKPKQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPAEGPQGSLAFLEQASANIPAPMKQT |
Length | 152 |
Position | Head |
Organism | Ictidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Sciuromorpha> Sciuridae>
Xerinae> Marmotini> Ictidomys.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.474 |
Instability index | 50.01 |
Isoelectric point | 6.07 |
Molecular weight | 16675.71 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14743
No repeats found
No repeats found
|