<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14729

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMQQQQQLQRMAQLQLQQQQQQQQQQALQAQPPMQQPPMQQPQPPPSQALPQQLQQLHHPQHHQPPPQPQPPVAQNQPSQLPPQSQTQPLVSQAATLPGQMLYAQPQLKLVRAPMVVQQPQVQPQVQPQVQPQTAVPTAQASQIVGSGVQVSQSSLTMLSSPSPSQQVQTPQSMPPPPQPSPQPGPPSSQPNSNVSSGPTPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCARKRRFEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSAA
Length513
PositionTail
OrganismSus scrofa (Pig)
KingdomMetazoa
Lineage
Aromaticity0.03
Grand average of hydropathy-0.662
Instability index93.58
Isoelectric point9.14
Molecular weight56540.91
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14729
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     208.15|      36|      36|     175|     210|       1
---------------------------------------------------------------------------
   24-   53 (45.76/ 8.62)	......QQAL.....QAQ..P....PMQQPPMQ...QPQPPPSQA..L.PQQL
   64-  106 (45.21/ 8.42)	PP...PQPQPpvaqnQPSqlP....PQSQTQPLVSQAATL.PGQM..LyAQPQ
  118-  162 (39.04/ 6.14)	QPqvqPQVQP.....QVQ..PqtavPTAQASQIVGSGVQVSQSSLtmL.SSPS
  175-  210 (78.14/20.57)	PP...PQPSP.....QPG..P....PSSQPNSNVSSGPTPSPSSF..L.PSPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.40|      23|      28|     288|     314|       2
---------------------------------------------------------------------------
  279-  306 (35.23/23.07)	DKNEdrkkdLSKMKSLLDILTDPSKRCP
  311-  335 (39.17/17.16)	QKCE...iaLEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14729 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MQQQQQLQRMAQLQLQQQQQQQQQQALQAQPPMQQPPMQQPQPPPSQALPQQLQQLHHPQHHQPPPQPQPPVAQNQPSQLPPQSQTQPLVSQAATLPGQMLYAQPQLKLVRAPMVVQQPQVQPQVQPQVQPQTAVPTAQASQIVGSGVQVSQSSLTMLSSPSPSQQVQTPQSMPPPPQPSPQPGPPSSQPNSNVSSGPTPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLS
1
265










Molecular Recognition Features






MoRF SequenceStartStop




NANANA