<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14728
| Description |
Cyclin dependent kinase 19 |
| Sequence | MSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDEPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPQQQNSTQTNGTAGGAGAGAGGAGAGLQHSQDSGLNQVPPNKKPRLGPSGTNSGGPVMPSDYQHSGSRLNYQSSVQGSSQSQSTLGYSSSSQQSAQYHPSHQAHRY |
| Length | 442 |
| Position | Kinase |
| Organism | Sus scrofa (Pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.657 |
| Instability index | 56.57 |
| Isoelectric point | 8.79 |
| Molecular weight | 49810.80 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14728
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.65| 16| 17| 259| 274| 1
---------------------------------------------------------------------------
259- 274 (27.33/12.86) DPTKRITSEQALQDPY
278- 293 (29.32/14.22) DPLPTLDVFAGCQIPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.19| 28| 37| 364| 400| 2
---------------------------------------------------------------------------
318- 358 (42.41/12.39) QHQQPTAPPQqaaAPPQAPPQqqnstqtngtAGGAGAGAGG
364- 391 (53.78/32.83) QHSQDSGLNQ...VPPNKKPR..........LGPSGTNSGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 119.22| 36| 40| 127| 166| 3
---------------------------------------------------------------------------
91- 117 (31.61/20.79) .........DLKPANILVMGEGPE.....RGRVKIADMgFA
120- 159 (59.27/56.92) FNSPLKPLADLDPVVVTFWYRAPELllgaRHYTKAIDI.WA
160- 181 (28.35/16.41) IGCIFAELLTSEPI...FHCRQEDI................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.15| 14| 15| 403| 416| 7
---------------------------------------------------------------------------
403- 416 (25.83/20.05) SRLNYQSSVQGSSQ
419- 432 (25.32/19.48) STLGYSSSSQQSAQ
---------------------------------------------------------------------------
|