<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14722
| Description |
Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | MSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAVMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYASPSDLLDDKTTSPIILHENNVPRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYVPLYELITQFELSKDPDPVPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGEPGLNCFTLPENQGALHFSTGWRRRGRINQAWDTSLLSRCTHSPVPKDGKDMKSTSTYLLLLVSCVFLV |
| Length | 567 |
| Position | Middle |
| Organism | Sus scrofa (Pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.131 |
| Instability index | 51.41 |
| Isoelectric point | 7.84 |
| Molecular weight | 62685.64 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14722
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 396.67| 129| 187| 108| 294| 1
---------------------------------------------------------------------------
124- 279 (201.77/183.49) M..YLALQSLEQD..LSKMAVMywkatnagPLDKILHGS.VGYLTPRSGGH...LMNLKYYASPSDLLDDKTTSPIILHENNvPRSLgmnasvtiegtsamyKLPIAPL......IMGSHPVDNKWTPSFSSITSANSVdlpACFFLK.FPQPIPVSRAFVQK.LQNCTGIP
312- 456 (194.90/91.23) MrfYAALPGQQHCyfLNKDAPL........PDGRSLQGTlVSKITFQHPGRvplILNLIRHQVAYNTLIGSCVKRTILKEDS.PGLL...............QFEVCPLsesrfsVSFQHPVNDSLVCVVMDVQDSTHV...SCKLYKgLSDALICTDDFIAKvVQRCMSIP
---------------------------------------------------------------------------
|