<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14712
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MLYAQPQLKLVRAPMVVQQPQVQPQVQPQVQPQTAVPTAQASQIVGSGVQVSQSSLTMLSSPSPSQQVQTPQSMPPPPQPSPQPGPPSSQPNSNVSSGPTPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCARKRRFEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSAA |
| Length | 414 |
| Position | Tail |
| Organism | Sus scrofa (Pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.483 |
| Instability index | 86.36 |
| Isoelectric point | 9.04 |
| Molecular weight | 45341.48 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14712
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 136.59| 21| 21| 61| 81| 1
---------------------------------------------------------------------------
61- 81 (45.05/14.89) SPSPSQQ...VQTPQSMP.PPPQPS
84- 104 (35.25/10.01) PGPPSSQ...PNSNVSSG.PTPSPS
111- 135 (27.45/ 6.12) SPQPSQSpvtARTPQNFSvPSPGPL
146- 166 (28.83/ 6.80) SPAGSSQ...AEEQQYLD.KLKQLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.57| 19| 28| 189| 215| 2
---------------------------------------------------------------------------
189- 207 (33.18/23.31) LSKMKSLLDILTDPSKRCP
218- 236 (35.39/11.18) LEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.05| 17| 17| 5| 21| 3
---------------------------------------------------------------------------
5- 21 (30.20/12.89) QPQLK.LVRAPMVVQQPQ
23- 40 (25.84/10.06) QPQVQpQVQPQTAVPTAQ
---------------------------------------------------------------------------
|