<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14712

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMLYAQPQLKLVRAPMVVQQPQVQPQVQPQVQPQTAVPTAQASQIVGSGVQVSQSSLTMLSSPSPSQQVQTPQSMPPPPQPSPQPGPPSSQPNSNVSSGPTPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCARKRRFEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSAA
Length414
PositionTail
OrganismSus scrofa (Pig)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
Aromaticity0.04
Grand average of hydropathy-0.483
Instability index86.36
Isoelectric point9.04
Molecular weight45341.48
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14712
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     136.59|      21|      21|      61|      81|       1
---------------------------------------------------------------------------
   61-   81 (45.05/14.89)	SPSPSQQ...VQTPQSMP.PPPQPS
   84-  104 (35.25/10.01)	PGPPSSQ...PNSNVSSG.PTPSPS
  111-  135 (27.45/ 6.12)	SPQPSQSpvtARTPQNFSvPSPGPL
  146-  166 (28.83/ 6.80)	SPAGSSQ...AEEQQYLD.KLKQLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.57|      19|      28|     189|     215|       2
---------------------------------------------------------------------------
  189-  207 (33.18/23.31)	LSKMKSLLDILTDPSKRCP
  218-  236 (35.39/11.18)	LEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.05|      17|      17|       5|      21|       3
---------------------------------------------------------------------------
    5-   21 (30.20/12.89)	QPQLK.LVRAPMVVQQPQ
   23-   40 (25.84/10.06)	QPQVQpQVQPQTAVPTAQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14712 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LKLVRAPMVVQQPQVQPQVQPQVQPQTAVPTAQASQIVGSGVQVSQSSLTMLSSPSPSQQVQTPQSMPPPPQPSPQPGPPSSQPNSNVSSGPTPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLS
8
166










Molecular Recognition Features






MoRF SequenceStartStop




1) LKLVRA
8
13