<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14706
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MQQQFQVAVQQQQQQLQQQQQQQQHLIKLHHQNQQQMQQQQQLQRMAQLQLQQQQQQQQQQALQAQPPMQQPPMQQPQPPPSQALPQQLQQLHHPQHHQPPPQPQPPVAQNQPSQLPPQSQTQPLVSQAATLPGQMLYAQPQLKLVRAPMVVQQPQVQPQVQPQVQPQTAVPTAQASQIVGSGVQVSQSSLTMLSSPSPSQQVQTPQSMPPPPQPSPQPGPPSSQPNSNVSSGPTPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCARKRRFEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSAA |
| Length | 549 |
| Position | Tail |
| Organism | Sus scrofa (Pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.734 |
| Instability index | 93.45 |
| Isoelectric point | 9.21 |
| Molecular weight | 61013.78 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14706
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.12| 26| 35| 49| 83| 2
---------------------------------------------------------------------------
49- 78 (52.32/10.27) L..QLQQQQQQQQQQalqaQPPMQQPPMQQPQ
85- 112 (43.80/ 8.46) LpqQLQQLHHPQHHQ....PPPQPQPPVAQNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.57| 19| 19| 7| 25| 4
---------------------------------------------------------------------------
3- 22 (30.78/ 9.69) QQFqVA...VQQQQQQLQQQQQQ
23- 42 (31.26/ 9.99) QQHlIK...LHHQNQQQMQQQQQ
143- 164 (26.52/ 7.00) LKL.VRapmVVQQPQVQPQVQPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.18| 18| 34| 183| 200| 5
---------------------------------------------------------------------------
183- 200 (31.82/14.32) GVQV..................SQSSLTMLSSPSPS
202- 237 (22.36/ 7.89) QVQTpqsmppppqpspqpgppsSQPNSNVSSGPTPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.62| 29| 35| 294| 324| 7
---------------------------------------------------------------------------
294- 324 (40.72/34.35) LDKLKQLSKYIePLRRMiNKID.KNEDRKKDL
331- 360 (46.90/29.78) LDILTDPSKRC.PLKTL.QKCEiALEKLKNDM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 115.73| 36| 112| 363| 401| 11
---------------------------------------------------------------------------
363- 398 (70.72/29.63) PTPPPPPV......PPTK......Q.QYLCQPLLDAVLANIRSPVF....NHS
477- 529 (45.01/11.70) PSVPPLELsvpadyPAQSplwidrQwQYDANPFLQSVHRCMTSRLLqlpdKHS
---------------------------------------------------------------------------
|