<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14694
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MSGVRAVRISIESACEKQVQEVGLDGTETYLQPLSMSQNLARLAQRIDFSQGSGSEEEEAAGADGDAQDWAGAGSSADQDDEEGLVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVREKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDIDLDKKIPEDYCPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLLCKEIFAQLSREAVQIKSQIPHIVVKNQIISQPFPSLQLSISLCHSSNDKKSQKSSTEKQSPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPFGHKRMRLSGPQAFDKNEINSIQSSEGLLEKIIKQAKHIFLRSRSIQLQLNIGVEQIRVVHRDGRVITLSHQEQELQDFLLSQMSQHQVHAVQQLAKVMGWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKVMVQFPRNQCKDLPKSDVLQDSKWNHLRGPFREVQWNKMEGRNFVYKMELLMSALSPCLL |
Length | 605 |
Position | Head |
Organism | Sus scrofa (Pig) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.440 |
Instability index | 57.14 |
Isoelectric point | 8.04 |
Molecular weight | 67721.47 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14694
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 248.69| 85| 110| 282| 391| 1
---------------------------------------------------------------------------
282- 376 (125.47/121.32) PKSKP.GspHWQTKLEAAQnVLLCKEIFAQLSREAV..QIKSQIPHIVVKNQIIsqpfpSLQLSISLCH...SSNDKKSQKSSTEKQSPEDHLyvL....EHNLH
395- 489 (123.22/68.79) PASAPfG..HKRMRLSGPQ.AFDKNEINSIQSSEGLleKIIKQAKHIFLRSRSI.....QLQLNIGVEQirvVHRDGRVITLSHQEQELQDFL..LsqmsQHQVH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.26| 23| 244| 1| 27| 5
---------------------------------------------------------------------------
1- 27 (32.92/33.45) MSGVRAVRISIesacEKQVQEVGLDGT
251- 273 (39.34/27.22) LEGSAYIKVSI....QKQAPDIGDLGT
---------------------------------------------------------------------------
|