<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14692
| Description |
Mediator complex subunit 30 |
| Sequence | MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKMEAVKDLKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 185 |
| Position | Head |
| Organism | Sus scrofa (Pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.564 |
| Instability index | 45.05 |
| Isoelectric point | 7.69 |
| Molecular weight | 21070.99 |
| Publications | PubMed=30723633
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP14692
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.82| 15| 34| 139| 153| 1
---------------------------------------------------------------------------
139- 153 (24.39/19.37) RREIAEVNKMEAVKD
171- 185 (27.42/22.59) RNLIWDINAMLAMRN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.55| 16| 34| 42| 60| 2
---------------------------------------------------------------------------
42- 60 (18.83/26.84) QDIVyRTMEIfqLLRNMQL
79- 94 (27.72/20.12) QDHL.RQLSI..LFRKLRL
---------------------------------------------------------------------------
|