| Description | Mediator complex subunit 22 |
| Sequence | MAQQRALPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAVDQRNQQLRALQEECDRKLIALRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDLDTDSADGLSAPPLMSPEPSAGPLQAAAPAHTHTGGPGPTEHS |
| Length | 200 |
| Position | Head |
| Organism | Sus scrofa (Pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.611 |
| Instability index | 62.72 |
| Isoelectric point | 4.56 |
| Molecular weight | 22323.59 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP14689 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AAPAH 2) YWRLDLD | 184 153 | 188 159 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab