Description | Mediator complex subunit 22 |
Sequence | MAQQRALPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAVDQRNQQLRALQEECDRKLIALRDEVSIDLYELEEEYYSSSSSLCEANDLPLCEAYWRLDLDTDSADGLSAPPLMSPEPSAGPLQAAAPAHTHTGGPGPTEHS |
Length | 200 |
Position | Head |
Organism | Sus scrofa (Pig) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Suina> Suidae> Sus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.611 |
Instability index | 62.72 |
Isoelectric point | 4.56 |
Molecular weight | 22323.59 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP14689 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) AAPAH 2) YWRLDLD | 184 153 | 188 159 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab