<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14677
Description |
Uncharacterized protein |
Sequence | MAAPLGGMFSAQLPGPSGAPPGLSSQPSLLQAAPGAPRSSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSLQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPAEMPQGSLAYLEQASANIPAPLKQT |
Length | 178 |
Position | Head |
Organism | Cavia porcellus (Guinea pig) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Caviidae>
Cavia.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.443 |
Instability index | 67.79 |
Isoelectric point | 5.40 |
Molecular weight | 19609.01 |
Publications | PubMed=21993624
|
Function
Annotated function |
|
GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP14677
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.23| 16| 17| 104| 119| 1
---------------------------------------------------------------------------
104- 119 (25.19/19.89) LQKPEQVIKEDVSELR
122- 137 (25.04/19.73) LQRKDALVQKHLTKLR
---------------------------------------------------------------------------
|