<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14665
Description |
Uncharacterized protein |
Sequence | MAAPQQQASAASSAAGVSGPGSAGGPGPQQQQQPPTQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLECANKVTGKTPTPPTGPGGTL |
Length | 200 |
Position | Tail |
Organism | Cavia porcellus (Guinea pig) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Caviidae>
Cavia.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.402 |
Instability index | 66.28 |
Isoelectric point | 5.87 |
Molecular weight | 21171.77 |
Publications | PubMed=21993624
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14665
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.86| 21| 48| 52| 72| 1
---------------------------------------------------------------------------
52- 72 (37.45/26.24) QDFDP.VQRYKMLIPQLKESLQ
100- 121 (33.41/22.71) QRFDKcLEEFYALCDQLELCLR
---------------------------------------------------------------------------
|