<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14659
| Description |
Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | MKAQGETEESEKLNKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAVMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYASPSDLLDDKTASPIILHENNVPRSLGMNASVTVEGTSAMYKLPIAPLIMGSHPADNKWTPSFSAITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFESQPTYVPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGILVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGVSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGVEEKRQNNQAWDTSLLSHCIHSTVSKNGKDVRSTSAYLLLLVSYLFLGFLIKICSDVHEDFRFEFRVS |
| Length | 615 |
| Position | Middle |
| Organism | Cavia porcellus (Guinea pig) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Caviidae>
Cavia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.168 |
| Instability index | 48.96 |
| Isoelectric point | 7.86 |
| Molecular weight | 68566.36 |
| Publications | PubMed=21993624
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14659
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 156.11| 38| 48| 146| 183| 2
---------------------------------------------------------------------------
146- 183 (65.20/46.59) NFD.....EFSKHLKGLVNLYNL..........P..GDNKLKTKMYLALQSLEQD
196- 234 (56.48/39.30) NAG.....PLDKILHGSVG.YLT..........PrsGGHLMNLKYYASPSDLLDD
246- 293 (34.43/20.88) NVPrslgmNASVTVEGTSAMYKLpiaplimgshP..ADNKW.TPSFSAITS....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.13| 14| 32| 526| 539| 3
---------------------------------------------------------------------------
526- 539 (22.48/15.42) SLIAETVEDMVKKN
561- 574 (24.65/17.58) SLLSHCIHSTVSKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 167.78| 46| 53| 364| 415| 4
---------------------------------------------------------------------------
299- 362 (49.24/31.91) ...LPA...CF...FLKFPQPIPVSRAfvqkLQNCtgiplfesqptyvpLYEL..ITqFelsKDPDPIPLNHNM....R
364- 415 (74.99/71.18) YAALPGQqhCY...FLNKDAPLPDGRS....LQGI..............LVSK..IT.F...QHPGRVPLILNMirhqV
417- 457 (43.56/25.99) YNTLIGS..CVkrtILKEDSPGLLQFE....VCPL..............SESRfsVS.F...QHP..............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.12| 18| 35| 505| 522| 5
---------------------------------------------------------------------------
505- 522 (30.17/23.58) PVTMRAIRRKAETIQA.DT
542- 560 (26.95/20.27) PASSPGVEEKRQNNQAwDT
---------------------------------------------------------------------------
|