<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14648

Description Cyclin
SequenceMATDFWSSTHFKRWIIDRQALQAARSEDLKYVEDPEHLALLSIFFASLIIKLGSKLNMRQRVIATAVVFFRRFYLKSSYCETDPFIVIGACCYVAAKAEESPLHIKTVISESRNVFAEYGIRYFPTENHKLAEMEFYLVADLECDLLVFHPYRTLMSLVKLSTSPDEEPFAEAEAGELGTGIDDGPRYWGTGEGRIILNPGGLQSAWFIINDTYLSDICLLYPPHLIAITALYLACILNPNVRQAHLDWQESRQASLNAPKSSGMTRRSSRHSGAGPVSAGSSTTIPQKRPHGIEREDSDSHKSSITAPVKPQDFVEFFANLNVNMRLIATIAQEIISFYALCERLKDDANPSSTVYSGKQFPMRILTQMEGKSSTVKPISTSTAVDSTYLIQMFTRMRVMKEPELAPLSARSAINKLLERTQGAG
Length426
PositionKinase
OrganismPyrrhoderma noxium
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Hymenochaetales> Hymenochaetaceae> Pyrrhoderma.
Aromaticity0.09
Grand average of hydropathy-0.149
Instability index50.05
Isoelectric point6.57
Molecular weight47699.05
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14648
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.55|      14|      16|     208|     223|       1
---------------------------------------------------------------------------
  208-  223 (23.13/24.03)	FI.INDTYLSdiCLLYP
  226-  240 (21.42/14.05)	LIaITALYLA..CILNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.92|      10|      15|     160|     169|       6
---------------------------------------------------------------------------
  160-  169 (18.16/12.87)	KLSTSPDEEP
  177-  186 (18.77/13.56)	ELGTGIDDGP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14648 with CycC domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SLNAPKSSGMTRRSSRHSGAGPVSAGSSTTIPQKRPHGIEREDSDSHKSSI
256
306










Molecular Recognition Features






MoRF SequenceStartStop




NANANA