<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14631
| Description |
Uncharacterized protein |
| Sequence | MLTELTHMDRITQLQDEIEQVLASPRPGESLTTSALSKLLTIMSNSLVYLTSRSNFLQVNPAVPVTKSRNPEKYDVAEIFEGNKRELVIDLIAKAKQVEYLIQSLPQPEAEEEQAKRLQRLQEEMSVADAEYAGALKRTKSLHAQVSEVLKTVLSDNHGPVR |
| Length | 162 |
| Position | Middle |
| Organism | Armillaria ostoyae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Physalacriaceae> Armillaria.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.398 |
| Instability index | 67.90 |
| Isoelectric point | 5.47 |
| Molecular weight | 18184.53 |
| Publications | PubMed=29085064
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14631
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.91| 18| 18| 109| 126| 1
---------------------------------------------------------------------------
109- 126 (28.01/17.34) EAEEEQA.KRLQRLQEEMS
129- 147 (23.90/13.93) DAEYAGAlKRTKSLHAQVS
---------------------------------------------------------------------------
|