<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14630
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MFNEAEGSSSDPKVANRARFEVELEFVQSLANPFYLHSLAQQNILEQPAFINFLEYLQYFQDKDYARFIHYPHALHHLELLQHAQFRAEMKKDEFLREYLHQKQFDHWRTWRDPTHTNKTNDTSPAVDGAEGPGTMSST |
Length | 139 |
Position | Middle |
Organism | Armillaria ostoyae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Physalacriaceae> Armillaria.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.785 |
Instability index | 45.65 |
Isoelectric point | 5.65 |
Molecular weight | 16400.98 |
Publications | PubMed=29085064
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14630
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.96| 12| 28| 24| 35| 1
---------------------------------------------------------------------------
24- 35 (21.48/15.06) LEFVQSLANPFY
54- 65 (22.48/16.09) LEYLQYFQDKDY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.02| 14| 34| 37| 50| 3
---------------------------------------------------------------------------
37- 50 (24.09/13.14) HSLAQQNILEQPAF
73- 86 (24.93/13.80) HALHHLELLQHAQF
---------------------------------------------------------------------------
|