<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14612
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MSRVAGGPSKKSSSRTMATKNMIIDEFKRRLRDNIKSLNDNFFHIIQAAKVSPDDNAYKNQTGKMTEFYTTKNEMAVRAQLMVRASDELLRLTTDLKEFLILHDFHFLTHNIKSAEAQCEDELRKQSQFHQAIDSDVSNMLLDLEREIGENFYLRHT |
| Length | 157 |
| Position | Head |
| Organism | Caenorhabditis latens |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.646 |
| Instability index | 52.82 |
| Isoelectric point | 7.02 |
| Molecular weight | 18243.49 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14612
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.51| 15| 75| 22| 37| 1
---------------------------------------------------------------------------
22- 37 (22.46/17.57) MIIDEFkRRLRDNIKS
100- 114 (27.04/16.43) LILHDF.HFLTHNIKS
---------------------------------------------------------------------------
|