<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14600
| Description |
Mediator of RNA polymerase II transcription subunit 8 (Fragment) |
| Sequence | MNFPYQNPAPPVTANYQGEPEKIAQATDMMIKRVTDAKKMIEELLQMLDLQEKCPWPDMLEKFSSLASAMSSLQTSVRKSGLPHGHEDYGQFLRSHVLVTQRLQYENDEALMRATQGRVFSWNHALVPEYLRTKPNPEMENEEQMLDGERSAKAADLVGRQIVAYNKNIEGLLINLNNIDRLHSEAINEKPTHNREETTKIVKSILTGEGIRTQRVVAPPPSTTPMSVPPGSAGGISTQAGSQIMNQTPGMQDYQSSQLRQQLMGSGGGPQQASQPHMGYGNAYQPQYPLQQQMHPQHPNQMPMMAPGQMNIGHQMQQRPMHQMPNMTIQRQ |
| Length | 332 |
| Position | Head |
| Organism | Caenorhabditis latens |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.767 |
| Instability index | 59.34 |
| Isoelectric point | 6.60 |
| Molecular weight | 37305.98 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14600
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 110.71| 23| 25| 281| 305| 1
---------------------------------------------------------------------------
254- 278 (29.80/ 8.61) ...YQSSQLRQQLMgsggGPQQASQ.PHM
281- 305 (47.27/21.90) GnaYQPQYPLQQQM....HPQHPNQMPMM
308- 327 (33.63/10.93) G.....QMNIGHQM..qqRPMH..QMPNM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.68| 29| 97| 33| 62| 2
---------------------------------------------------------------------------
33- 62 (46.80/34.73) RVTDAKKMiEELLQMLDLQEKCPWPDMLEK
132- 160 (46.87/29.89) RTKPNPEM.ENEEQMLDGERSAKAADLVGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.25| 12| 27| 210| 221| 4
---------------------------------------------------------------------------
210- 221 (22.82/18.46) GIRTQ...RVVAPPP
235- 249 (17.43/11.85) GISTQagsQIMNQTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.42| 12| 27| 92| 103| 6
---------------------------------------------------------------------------
92- 103 (20.58/13.28) FLRSHVLVTQRL
120- 131 (23.83/16.31) FSWNHALVPEYL
---------------------------------------------------------------------------
|