<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14588
| Description |
Uncharacterized protein |
| Sequence | MDPETKNFGKGPRELTGAVDLISCYKLLPHYEFFCKKSLPLSISDTHYLHDIVGDTDIRKGEGMQLDQLIHNSSLSRDATNTRIQPFDLNTLAEAFQLRDTAPVDLPSSEKGMATIAGKSRSESKDKEKKHKKHKDKEHKKHKHRHKDRSKDKDKEKKKDKSSHHDKKRKYDGNEDVSDIHKQKKSKHKNSKIEEIGAFKIAA |
| Length | 203 |
| Position | Head |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.297 |
| Instability index | 42.16 |
| Isoelectric point | 9.48 |
| Molecular weight | 23306.09 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14588
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.97| 21| 21| 129| 149| 1
---------------------------------------------------------------------------
129- 149 (39.89/14.32) KKHKKHKDKE..HKKHKHRHKDR
151- 167 (24.53/ 6.50) ....KDKDKE..KKKDKSSHHDK
169- 190 (24.55/ 6.50) RKYDGNEDVSdiHKQKKSKHKN.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.40| 14| 20| 69| 88| 2
---------------------------------------------------------------------------
69- 88 (15.11/31.25) LIHNSSLsRDATntriqPFD
92- 105 (24.29/18.78) LAEAFQL.RDTA.....PVD
---------------------------------------------------------------------------
|