<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14587
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MYLFRKSYCKWQQLLIHLHHRITGCTRITNKTLPLLPNRPLLFKGPTNYMAPLTLVTDDVLPSLEDQGVRQLYPKGPNVDFKKELRSLNRELQLHILELADVLIERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKEALGTLEGQ |
| Length | 179 |
| Position | Middle |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.451 |
| Instability index | 62.94 |
| Isoelectric point | 9.90 |
| Molecular weight | 21074.40 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14587
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.37| 27| 44| 85| 117| 1
---------------------------------------------------------------------------
85- 117 (36.90/36.47) LRSLN.......RELQLHILELAdvlIERPSQyarRVEDI
125- 158 (41.47/24.16) HHLLNslrphqaRATLIHILELQ...IQRRKQ...AVEDI
---------------------------------------------------------------------------
|