<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14586
| Description |
Putative cyclin family protein |
| Sequence | MATNFWASTHYKELLEQEEVDVVHNLDKQRGITLDDFKLIKLHMSNYIAKLAQSVKVRQRVVATAVTYMRRVYTRRSMTEYDPRLLAPSCLYLAAKSEESTVQARLLVFYIKKLNLDEKYRCEIKEILEMEMKILEALNYYLIVFHPYQSLPQLVHDAGMSDATQLIWGLVNDTYKMDLILIHPPHLIGLACIYVASVLKEKDNTAWFEDLRADMNVVKNIAMEILDFYDTHKMITEDRVNAAMHKLSIRI |
| Length | 251 |
| Position | Kinase |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.097 |
| Instability index | 52.05 |
| Isoelectric point | 6.51 |
| Molecular weight | 29334.93 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14586
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.75| 10| 35| 142| 155| 2
---------------------------------------------------------------------------
142- 155 (14.53/20.42) LIVFHPyqslPQLV
179- 188 (20.22/13.15) LILIHP....PHLI
---------------------------------------------------------------------------
|