<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14582
| Description |
Putative transcription factor IIS |
| Sequence | MGSEFLRVKGVLDSIRETGEETRMIGEVSRIKAILNSSGYKSEQVLCDLLSKLKPMVVSMKVLEVSMIGVSVTGLMNHTSKDVRQTARMLVRSWRRMVGEWVVGNDNMPAVQDEECYESNKKYLPIEKPVGPTGFNGANKKPKEPKLQHKKPLTMVVLEKQSTAVDRRKPSAAVETMKLQMPTKSVVSLMSSDKRSVEEKLEATKRKIQERYKEAEKTKRQRRIQVIEVHDVLRLGLAPKHQDNKFGKHFSHRISSV |
| Length | 257 |
| Position | Unknown |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.594 |
| Instability index | 50.84 |
| Isoelectric point | 9.90 |
| Molecular weight | 29213.78 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14582
No repeats found
|