<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14568
| Description |
"Putative coactivator CBP, KIX domain-containing protein" |
| Sequence | MIYPPIALCSPVTKTLTPRIRHLKPTQGENCSVAMESGDWRDQLQRQTFLCKIMDTLKRHLPFSKYERLQELKKIAERVEQEIYTVATNQSEYTRKICFMMLTMETRLQNPVRSKSNSAILYNSVNPSIPLDSSANGDWQEEVYQQIKAMKDLYLLDSTAQTGNPNGEDVQEEVYQKIKAMKDLYLLDLFDMHQKIVSKFQQLDSLPQQPENEVLEKLKVFKNMLERYMQFLQIPKHGILANYKDKLCTYERQIISVINVNKGKPGPSQQQSRA |
| Length | 274 |
| Position | Tail |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.612 |
| Instability index | 42.60 |
| Isoelectric point | 8.79 |
| Molecular weight | 31900.44 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14568
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.20| 22| 29| 136| 157| 1
---------------------------------------------------------------------------
136- 157 (47.48/32.24) NG.DWQEEVYQQIKAMKDLYLLD
166- 188 (40.72/26.76) NGeDVQEEVYQKIKAMKDLYLLD
---------------------------------------------------------------------------
|