<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14566
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEKSFSKLTSRPILCFRCRINLLTIYSTLVDRLKDVERDCMASGQEIDDSSNKNSSPKKVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKYIMYPHCLYFLELLQNASFRNAMAHPANKELTHRQQFYFWKNYRNNRLKHILPRPLPEPTAAPPSNALPPPLPPSATTMATSSAPVSAPPVPSPMQYGVPSGPPLVKNDPRNAIDRRKRKKDG |
| Length | 241 |
| Position | Middle |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.665 |
| Instability index | 58.29 |
| Isoelectric point | 9.41 |
| Molecular weight | 27972.81 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14566
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.11| 18| 18| 187| 204| 1
---------------------------------------------------------------------------
171- 185 (27.38/12.06) PRPLPEPT...AAPPSNA
187- 204 (33.84/16.52) PPPLPPSATTMATSSAPV
206- 221 (26.89/11.71) APPV.PSPMQYGVPSGP.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.97| 20| 27| 71| 90| 2
---------------------------------------------------------------------------
71- 90 (37.17/25.37) FLLELEFVQCLANPTYIHYL
101- 120 (39.81/27.66) FIGYLKYLQYWQRPEYIKYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.15| 13| 27| 126| 138| 4
---------------------------------------------------------------------------
126- 138 (21.61/12.51) LYFLELLQNASFR
155- 167 (25.54/15.87) FYFWKNYRNNRLK
---------------------------------------------------------------------------
|