Description | Putative MED32 |
Sequence | MDDIVDAMNNAYQEFVVAIASTLEAKEASGGQVTAATDAALENLKQSRELFRVACDQAEEFVESVKLRIGSECLVDEATGSVAGKPGQPVTPGLPPISAVRLEQMSKAVRWLVLELQQGSGSAGNLSMPQHSSAPFDARFHEDSTQ |
Length | 146 |
Position | Tail |
Organism | Helianthus annuus (Common sunflower) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Asteroideae> Heliantheae alliance> Heliantheae> Helianthus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.200 |
Instability index | 54.13 |
Isoelectric point | 4.52 |
Molecular weight | 15549.20 |
Publications | PubMed=28538728 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
Binary Interactions |
Repeats | >MDP14557 No repeats found |
MoRF Sequence | Start | Stop |
1) KAVRWLVLEL 2) LPPISAVRL 3) PFDARFHEDSTQ | 107 94 135 | 116 102 146 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab