<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14552
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MGLKKQKKFPRVQTESHDSLRGTVLLGFFTSTTGSLSDTPISSSPPSPASATNPPPSAGISALSHSADQDDAIRLLKNSIVSRLQGLKRKPNFWIELMDSQTQNASLLRLQTVEKRIVRVLELAGGVMEEFSNPNGPRKELVNSHCSEFMQIIKDIQVTLREEIKSACEYRPFEKCDYIARVSNEICCKKLEYVVDKLDGMKEIMDQYHQAT |
Length | 212 |
Position | Head |
Organism | Helianthus annuus (Common sunflower) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.443 |
Instability index | 39.86 |
Isoelectric point | 8.24 |
Molecular weight | 23744.93 |
Publications | PubMed=28538728
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14552
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.62| 16| 19| 162| 177| 1
---------------------------------------------------------------------------
140- 155 (21.76/11.88) ELVNSHCsEFMQI..IK.D
162- 177 (30.15/18.72) EEIKSAC.EYRPF..EKCD
184- 199 (19.71/10.21) NEI..CC.KKLEYvvDKLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.64| 14| 24| 77| 90| 2
---------------------------------------------------------------------------
77- 90 (21.96/17.16) KNSIVSRLQGLKRK
103- 116 (21.67/16.85) QNASLLRLQTVEKR
---------------------------------------------------------------------------
|