<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14551

Description "Putative zinc finger, RING/FYVE/PHD-type"
SequenceMKLLRPSHPSATMVTGTCSGFSPPATFRDGFGRNIPPVPEIVGGGDDKVYVAVGKSVEKAVALFHWTFRRFRDREICILHVHQPSPLIPTLLGKLPATQANPDVVCAYRREERDAMQKLLLDYVSLCARSKVKACVVTTENDQVRKGIVDLVNEYRVQKLVMGAATENWMKVKKNSSKSSYAAKNAPPFCQIWFVNKGQLLHTREPSEDYNILPPSVQDSSALRSQSLHCPNTEREIPQIYCRSSSSTSFIPRSTSMTRSLQSNTSSESEYSSEHDLRVEEESLCKQLDEVNLEAEASRNEAFQELLKRKRLEAQALEANNKVKAYESAHAQEVELRKAAEDKLNAARRENEQLLEQRESTSKEWHKLLRNIAILENQVQEANRRREESSEELKLIQASVATLKIEKLTLQRQRFEAANWLDRWKVRGQPAGASSTTSRLTEFSLVDLETATCGFSESFKIGCESYGCSLYKGEMSNRTVMIKKLHRNNLQAQQEFQEEVQVVGRLKHKHILSLIGICHEAHALVYEYTPTRLESHLSHKTNSYSMSWKTRTRVIFEIANALLFLHSSRPEKLLHGNLSPENIVLDSEFCCKLCNFRFSKLVNEETFRCRSFRQYSEPSSNGHYLFTDPEFLQTGDLTAKSDVYSFGMIILWLLTGSRASGLANIVRRAVSGSNLVSVLDASAGEWSGFVARRLADLGLRCCDSNSADRPAISLVMVKELEHLSALEDRRVPSSFLCPILKEIMHDPQLAADGFTYEGEALRGWLKNGRETSPMTNLKLDHLNLTPNHSIRLAIQDWLCNP
Length801
PositionTail
OrganismHelianthus annuus (Common sunflower)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Asteroideae> Heliantheae alliance> Heliantheae> Helianthus.
Aromaticity0.07
Grand average of hydropathy-0.445
Instability index54.61
Isoelectric point8.34
Molecular weight90600.96
Publications
PubMed=28538728

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14551
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.74|      26|      26|     343|     368|       1
---------------------------------------------------------------------------
  343-  368 (44.13/30.20)	KLNAARRENE.QLLEQRES.TSKEWHKL
  371-  395 (27.63/16.02)	..NIAILENQvQEANRRRE.ESSEELKL
  402-  420 (17.98/ 7.72)	TL.....KIE.KLTLQRQRfEAANW...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.88|      22|      26|     122|     146|       2
---------------------------------------------------------------------------
  122-  146 (32.52/31.34)	DYVSlcaRSKVKACVV..TTEN.DQVRK
  150-  174 (27.36/16.78)	DLVN...EYRVQKLVMgaATENwMKVKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     125.14|      36|     110|     630|     665|       3
---------------------------------------------------------------------------
  630-  665 (60.50/37.58)	EFLQTGDLTAKSDVYSFGMIILWLLTGSRASGLANI
  742-  777 (64.64/40.60)	EIMHDPQLAADGFTYEGEALRGWLKNGRETSPMTNL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.49|      24|      26|     187|     212|       4
---------------------------------------------------------------------------
  187-  212 (42.79/29.68)	PPFCQIWFVNKGQLLHTrePSEDYNI
  214-  237 (42.69/23.65)	PPSVQDSSALRSQSLHC..PNTEREI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14551 with Med32 domain of Kingdom Viridiplantae
Unable to open file!