<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14551

Description "Putative zinc finger, RING/FYVE/PHD-type"
SequenceMKLLRPSHPSATMVTGTCSGFSPPATFRDGFGRNIPPVPEIVGGGDDKVYVAVGKSVEKAVALFHWTFRRFRDREICILHVHQPSPLIPTLLGKLPATQANPDVVCAYRREERDAMQKLLLDYVSLCARSKVKACVVTTENDQVRKGIVDLVNEYRVQKLVMGAATENWMKVKKNSSKSSYAAKNAPPFCQIWFVNKGQLLHTREPSEDYNILPPSVQDSSALRSQSLHCPNTEREIPQIYCRSSSSTSFIPRSTSMTRSLQSNTSSESEYSSEHDLRVEEESLCKQLDEVNLEAEASRNEAFQELLKRKRLEAQALEANNKVKAYESAHAQEVELRKAAEDKLNAARRENEQLLEQRESTSKEWHKLLRNIAILENQVQEANRRREESSEELKLIQASVATLKIEKLTLQRQRFEAANWLDRWKVRGQPAGASSTTSRLTEFSLVDLETATCGFSESFKIGCESYGCSLYKGEMSNRTVMIKKLHRNNLQAQQEFQEEVQVVGRLKHKHILSLIGICHEAHALVYEYTPTRLESHLSHKTNSYSMSWKTRTRVIFEIANALLFLHSSRPEKLLHGNLSPENIVLDSEFCCKLCNFRFSKLVNEETFRCRSFRQYSEPSSNGHYLFTDPEFLQTGDLTAKSDVYSFGMIILWLLTGSRASGLANIVRRAVSGSNLVSVLDASAGEWSGFVARRLADLGLRCCDSNSADRPAISLVMVKELEHLSALEDRRVPSSFLCPILKEIMHDPQLAADGFTYEGEALRGWLKNGRETSPMTNLKLDHLNLTPNHSIRLAIQDWLCNP
Length801
PositionTail
OrganismHelianthus annuus (Common sunflower)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Asteroideae> Heliantheae alliance> Heliantheae> Helianthus.
Aromaticity0.07
Grand average of hydropathy-0.445
Instability index54.61
Isoelectric point8.34
Molecular weight90600.96
Publications
PubMed=28538728

Function

Annotated function Functions as an E3 ubiquitin ligase. 
ECO:0000256	ARBA:ARBA00003861
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14551
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.74|      26|      26|     343|     368|       1
---------------------------------------------------------------------------
  343-  368 (44.13/30.20)	KLNAARRENE.QLLEQRES.TSKEWHKL
  371-  395 (27.63/16.02)	..NIAILENQvQEANRRRE.ESSEELKL
  402-  420 (17.98/ 7.72)	TL.....KIE.KLTLQRQRfEAANW...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.88|      22|      26|     122|     146|       2
---------------------------------------------------------------------------
  122-  146 (32.52/31.34)	DYVSlcaRSKVKACVV..TTEN.DQVRK
  150-  174 (27.36/16.78)	DLVN...EYRVQKLVMgaATENwMKVKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     125.14|      36|     110|     630|     665|       3
---------------------------------------------------------------------------
  630-  665 (60.50/37.58)	EFLQTGDLTAKSDVYSFGMIILWLLTGSRASGLANI
  742-  777 (64.64/40.60)	EIMHDPQLAADGFTYEGEALRGWLKNGRETSPMTNL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.49|      24|      26|     187|     212|       4
---------------------------------------------------------------------------
  187-  212 (42.79/29.68)	PPFCQIWFVNKGQLLHTrePSEDYNI
  214-  237 (42.69/23.65)	PPSVQDSSALRSQSLHC..PNTEREI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14551 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




NANANA