<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14544
| Description |
Uncharacterized protein |
| Sequence | MNQRLPASFHQQRAMLEASSRSLDSTAQTGNSNGGDCQEEVYQKVKAMKDQYFQGLADLYPKILGKLQQVVLLLNGSLYLNLVSIESQWLDPFKKAEVCLRIKSEQSQKSG |
| Length | 111 |
| Position | Tail |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.496 |
| Instability index | 46.65 |
| Isoelectric point | 8.58 |
| Molecular weight | 12467.07 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14544
No repeats found
No repeats found
|