<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14543
| Description |
Uncharacterized protein |
| Sequence | MDLESKKFGKGPKELTGAVNLVQYYKLFPHYEFFCKKSTSLSVLDAHYLHNVVGDKEIRKGEGMQLNQLINDNKSISQEAIHPFDLNALGDAFHLRETAPIELPDSQKGVPTQAGRSKSELNGKEKKHKKHKDKEHKKHKHHHHHKDKKNENDKINPRDSGAEHLKKPHEKKRKVDGDEDLSGIHRHQNTKYKRSKMDEFGVIRIAA |
| Length | 207 |
| Position | Head |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.232 |
| Instability index | 36.63 |
| Isoelectric point | 9.49 |
| Molecular weight | 23839.70 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14543
No repeats found
No repeats found
|