<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14541
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASGQEIDDSSNNNSSPKKVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKYIMYPHCLYFLELLQNASFRNAMAHPANKELTHRQQFYFWKNYRNNRLKHILPRPLPEPTVAPPSNALPPLLPPTATTMAASSAPVSAPPVPSPMQYGVPSGPPLAKNDPRNAIDRRKRKKDG |
Length | 201 |
Position | Middle |
Organism | Helianthus annuus (Common sunflower) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.737 |
Instability index | 62.42 |
Isoelectric point | 9.33 |
Molecular weight | 23212.18 |
Publications | PubMed=28538728
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP14541
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.12| 15| 17| 147| 163| 1
---------------------------------------------------------------------------
147- 163 (22.25/12.22) PPLlpPTATTMAASSAP
167- 181 (29.87/11.16) PPV..PSPMQYGVPSGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.97| 20| 27| 31| 50| 2
---------------------------------------------------------------------------
31- 50 (37.17/20.77) FLLELEFVQCLANPTYIHYL
61- 80 (39.81/22.65) FIGYLKYLQYWQRPEYIKYI
---------------------------------------------------------------------------
|