<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14534
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MPIKWVLPWQPNAGHTVNSQILAEVSQCVVESINGLKEGKWKATLSFYRPLLKDQANAAEFPRDFLGISLPEQPNKYYFVLRGHRLVVEADSTIQTIMEKLQSYKTRVALNFEGFQYQLGDFQLRVGKVVSIQSESLRGIVMEMEYKPSSSWEKSHKIMGEFFDIWQEALSKRQLPGHFVHMEPNFGEYGLSGQYTLQHTAVQYATLMLQMIASVQAVRN |
Length | 220 |
Position | Head |
Organism | Helianthus annuus (Common sunflower) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.270 |
Instability index | 35.25 |
Isoelectric point | 7.84 |
Molecular weight | 25233.70 |
Publications | PubMed=28538728
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP14534
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 136.94| 41| 62| 7| 47| 1
---------------------------------------------------------------------------
7- 47 (71.87/52.91) LPWQPNAGHTV..NSQILAEVSQCVVESINGLKEGKWKATLSF
70- 112 (65.08/47.28) LPEQPNKYYFVlrGHRLVVEADSTIQTIMEKLQSYKTRVALNF
---------------------------------------------------------------------------
|