<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14530
| Description |
Putative transcription factor IIS |
| Sequence | MGSKSAARMGYWREYFKTSNGDIFETIEKAIMIAACDYPKEFGVRRDGIAQTLFNCKLIKCYGCDKVELGVPDEEQDDRDDGDNRKEIRAVDRQVSSYSYGVAEALTDEIEEESQVFGEVMRIREIVDNHQDESESVLYNSLRKLQLMDLSVETLKATEIGKSVNVLRKHVSKDVSSIAKTLIEAWKILVDEWVMATEKTVVSEATPDSLNPSVLDEEEGLPSPPLDDLTFLYPHGSLELSEFFDGMDEYGNPGNSGGFNKNHNSPKPKQQKPSNVPNTVRKNEPGFDSMKRKQPTVVKPIKPAVPESEPRQRVKPNVERKLQNVLKRPPQQIKQRASGEATAQEKFEAAKRKLQERYQEAKDAKKQRTIQVMELHDLPKPKGVPVRNQQNVRPGSNHNRHR |
| Length | 402 |
| Position | Unknown |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.871 |
| Instability index | 48.49 |
| Isoelectric point | 6.45 |
| Molecular weight | 45634.92 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14530
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 107.99| 27| 31| 255| 283| 1
---------------------------------------------------------------------------
257- 283 (51.14/27.28) GGFNK.NHNSP...KP.KQQKPSNVP.NTVRKN
285- 317 (32.23/10.65) PGFDSmKRKQPtvvKPiKPAVPESEPrQRVKPN
376- 391 (24.62/ 8.45) .......HDLP...KP.K.....GVP.VRNQQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.22| 18| 33| 319| 336| 2
---------------------------------------------------------------------------
319- 336 (31.27/22.23) ERKLQNVLKRPPQQIKQR
351- 368 (29.95/20.98) KRKLQERYQEAKDAKKQR
---------------------------------------------------------------------------
|