Description | Putative mediator 21 |
Sequence | MDIISQLQEQVNTIAAIAFNTFGTLQRDAPPVRLSPNYPEPPSAPAAPTAAAGGAAANGAAANPSTEESPSNNISETPKLLSAELVKAAKQFDALVAALPFSEGGEEAQLKKIEQLQAENDLVGQELQKQLEAADKELKQVQELFNEAADNCLNLKKPD |
Length | 159 |
Position | Middle |
Organism | Helianthus annuus (Common sunflower) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Asteroideae> Heliantheae alliance> Heliantheae> Helianthus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.397 |
Instability index | 59.99 |
Isoelectric point | 4.42 |
Molecular weight | 16777.50 |
Publications | PubMed=28538728 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP14528 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.07| 14| 16| 105| 119| 1 --------------------------------------------------------------------------- 105- 119 (18.31/13.23) GEEAQlKKIEQLQAE 124- 137 (22.76/12.08) GQELQ.KQLEAADKE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AQLKKIEQLQ 2) ISETPKLLSAELVKAAK | 108 74 | 117 90 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab