<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14528
| Description |
Putative mediator 21 |
| Sequence | MDIISQLQEQVNTIAAIAFNTFGTLQRDAPPVRLSPNYPEPPSAPAAPTAAAGGAAANGAAANPSTEESPSNNISETPKLLSAELVKAAKQFDALVAALPFSEGGEEAQLKKIEQLQAENDLVGQELQKQLEAADKELKQVQELFNEAADNCLNLKKPD |
| Length | 159 |
| Position | Middle |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.397 |
| Instability index | 59.99 |
| Isoelectric point | 4.42 |
| Molecular weight | 16777.50 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14528
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.07| 14| 16| 105| 119| 1
---------------------------------------------------------------------------
105- 119 (18.31/13.23) GEEAQlKKIEQLQAE
124- 137 (22.76/12.08) GQELQ.KQLEAADKE
---------------------------------------------------------------------------
|