<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14507
Description |
Uncharacterized protein |
Sequence | MMLSMETRLLNPMRSKSNAAIFYNSVNSSVPLDSSANGDWQEEVYQQIKAMKDPTGKDMQEEVYQKGCHCYQRK |
Length | 74 |
Position | Tail |
Organism | Helianthus annuus (Common sunflower) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.846 |
Instability index | 39.15 |
Isoelectric point | 6.54 |
Molecular weight | 8538.60 |
Publications | PubMed=28538728
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14507
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.06| 10| 16| 38| 47| 1
---------------------------------------------------------------------------
38- 47 (22.53/13.58) G.DWQEEVYQQ
56- 66 (16.54/ 8.75) GkDMQEEVYQK
---------------------------------------------------------------------------
|