<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14501

Description "Putative fibrillarin, S-adenosyl-L-methionine-dependent methyltransferase"
SequenceMRAPMRGGGGRGGGFSGGRSGGFSGGRGDGGGRGGGRGRGGFSGGRGRGGGEMTRGGGRSGGRGGRGGRGGRGGRGGGMKGGSKVIVEPHRHDGVFIAKGKEDALCTKNMVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKLAAAVLGGVDNIWMKPGSKVLYLGAASGTTVSHVSDLVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKSGGYFVISIKANCIDSTVPAEAVFASEVKKLQAEQFKPMEQVTLEPFERDHACVVGAYRVPKKQKPAS
Length323
PositionUnknown
OrganismHelianthus annuus (Common sunflower)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Asteroideae> Heliantheae alliance> Heliantheae> Helianthus.
Aromaticity0.07
Grand average of hydropathy-0.402
Instability index33.64
Isoelectric point10.20
Molecular weight33855.16
Publications
PubMed=28538728

Function

Annotated function 
GO - Cellular Component
box C/D RNP complex	GO:0031428	IBA:GO_Central
Cajal body	GO:0015030	IBA:GO_Central
small-subunit processome	GO:0032040	IBA:GO_Central

GO - Biological Function
histone-glutamine methyltransferase activity	GO:1990259	IBA:GO_Central
RNA binding	GO:0003723	IBA:GO_Central
rRNA methyltransferase activity	GO:0008649	IBA:GO_Central

GO - Biological Process
box C/D RNA 3'-end processing	GO:0000494	IBA:GO_Central
histone glutamine methylation	GO:1990258	IBA:GO_Central
rRNA methylation	GO:0031167	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14501
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     109.42|      16|      17|      17|      32|       1
---------------------------------------------------------------------------
   17-   32 (39.38/11.84)	GGRS.GGFSGGRGDGGG
   35-   51 (35.38/ 9.90)	GGRGrGGFSGGRGRGGG
   57-   71 (34.67/ 9.55)	GGRS.GG.RGGRGGRGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.03|      17|      17|     204|     220|       2
---------------------------------------------------------------------------
  184-  207 (20.30/11.64)	TGVVYAVEfshrsgrDLVNMAKKR
  208-  224 (30.72/20.70)	TNVIPIIE.......DARHPAKYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     136.12|      41|     161|      91|     133|       5
---------------------------------------------------------------------------
   91-  133 (66.33/58.39)	RHDGVFIAKGKedALCTKNMVPGEAVYNEKRISVQNEDGTKVE
  255-  295 (69.78/54.00)	KSGGYFVISIK..ANCIDSTVPAEAVFASEVKKLQAEQFKPME
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14501 with Med36 domain of Kingdom Viridiplantae
Unable to open file!