Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MLPPNLVAGSGNMEGNAAAATPTLGTDMTGICFRDQLWLNTYPLDHNLVFDYFALSPFYDYTCNNEQLRMRSIHPLDISHLSEVMEPHLFMMRKQKRDGPEVTPMLTYYVLDGSIYQAQLCNVFSARVGRALYYISKAFTTVASKLEKVGYVDSEDDSTSHEPKAAKETIDFKEVKRVDHILASLQRKLPAAPPPPPFPEGYTPPSTAKGEQGPETEQADPSIDPILDQGPAKRTKYA |
Length | 238 |
Position | Head |
Organism | Helianthus annuus (Common sunflower) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Asteroideae> Heliantheae alliance> Heliantheae> Helianthus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.447 |
Instability index | 46.51 |
Isoelectric point | 5.38 |
Molecular weight | 26516.77 |
Publications | PubMed=28538728 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP14500 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.74| 14| 29| 32| 45| 1 --------------------------------------------------------------------------- 32- 45 (29.36/19.68) CFRDQLWL.NTYPLD 63- 77 (23.38/14.41) CNNEQLRMrSIHPLD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FKEVKRVDHILASLQRKLP 2) TEQADPSIDPILDQGPAKRTKYA | 172 216 | 190 238 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab