<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14500
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MLPPNLVAGSGNMEGNAAAATPTLGTDMTGICFRDQLWLNTYPLDHNLVFDYFALSPFYDYTCNNEQLRMRSIHPLDISHLSEVMEPHLFMMRKQKRDGPEVTPMLTYYVLDGSIYQAQLCNVFSARVGRALYYISKAFTTVASKLEKVGYVDSEDDSTSHEPKAAKETIDFKEVKRVDHILASLQRKLPAAPPPPPFPEGYTPPSTAKGEQGPETEQADPSIDPILDQGPAKRTKYA |
| Length | 238 |
| Position | Head |
| Organism | Helianthus annuus (Common sunflower) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.447 |
| Instability index | 46.51 |
| Isoelectric point | 5.38 |
| Molecular weight | 26516.77 |
| Publications | PubMed=28538728
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14500
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.74| 14| 29| 32| 45| 1
---------------------------------------------------------------------------
32- 45 (29.36/19.68) CFRDQLWL.NTYPLD
63- 77 (23.38/14.41) CNNEQLRMrSIHPLD
---------------------------------------------------------------------------
|