<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14495
Description |
Putative transcription factor IIS |
Sequence | MGSEFLRVKGVLDSIRETEEETRMIGEVLRIKAILNSSGYKSEQVLCELLSKLKQMVVSMKVLQVSMIGVSVTGLMNHASKDVRRTARMLVRSWRRMVGEWVVSNDNMPAVQDEECYESNKKYLPIEKPVGPTVFNGANKKPKEPKLQHKKPLTMVVLEKQSTAVDRRKPSATVETMKLQMPTKSVVSSMSSDKRSVEEKLEATKRKIQECYKEAEKNKRQRRIQVIEVHDVLRLGLAPKHRDSRFGKHISHRISSV |
Length | 257 |
Position | Unknown |
Organism | Helianthus annuus (Common sunflower) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> campanulids> Asterales> Asteraceae> Asteroideae>
Heliantheae alliance> Heliantheae> Helianthus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.574 |
Instability index | 63.59 |
Isoelectric point | 9.93 |
Molecular weight | 29385.05 |
Publications | PubMed=28538728
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14495
No repeats found
|