<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14488

Description "Putative mediator complex, subunit Med25, von Willebrand factor type A"
SequenceMDAEKKQLVLVVEGTAALGPHWRIIVSDYLEKVIRKFCGNEAKEVGSSIVELALVQFNAHGSYSSCLVQRSGWARNVDYFLEWLSCMQFGGGGFCDAAIAEGLAEVLMMCPPPNGTDTRPTDVVQRHCILVAASNPYPLPTPVYRPPNKSDTQSENRLFDAETIAKSFPQSCVSLSVICPKQLPKLKAIYNAGKRNPSATVPTVDIVKTPHYLILISEDFTEACDALSPSVTTNSPSSQNPSSMNITSVSPVNKSLLAQQPVPLATVKAVRIFNPLFYTIYNHVCDFNFFNLILQEPCTVSPITSPQAKTYSPSPTSQERISRNDHLQDMKPVVSNIQQPLRPAGPVNVSILNNLSQARLASPTVLAGGTATGISSIGGQAIHMSNMIAGSVSAPLSGTAQVAQHVGSMMAAPGMSQQVQGMQSVGVDNNMGTNVGVSQLTSSALQAGRPKYLKIWEVCKVATLYLKSM
Length469
PositionUnknown
OrganismHelianthus annuus (Common sunflower)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> campanulids> Asterales> Asteraceae> Asteroideae> Heliantheae alliance> Heliantheae> Helianthus.
Aromaticity0.06
Grand average of hydropathy-0.028
Instability index54.32
Isoelectric point8.38
Molecular weight50368.26
Publications
PubMed=28538728

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
transcription regulator complex	GO:0005667	IBA:GO_Central

GO - Biological Function
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14488
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     174.08|      39|      78|     238|     276|       2
---------------------------------------------------------------------------
  133-  150 (20.05/ 6.43)	........................................ASNPY.PLPT.PVYRPPNKS
  154-  210 (39.77/19.60)	SENRlfDAET..IAKSFPqscVSLSVIcpkqlpklkaiynAGKRN.PSATVPTVDIVKTP
  238-  276 (65.68/36.90)	SQNP..SSMN..ITSVSP...VNKSLL.............AQQPV.PLATVKAVRIFNPL
  317-  355 (48.59/25.49)	SQER..ISRNdhLQDMKP...VVSNI...............QQPLrPAGPVN.VSILNNL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.35|      27|      50|     360|     394|       3
---------------------------------------------------------------------------
  368-  394 (47.05/26.16)	GGTATGISSIGGQ..AIHMSNMIAGSVSA
  397-  425 (43.30/31.32)	SGTAQVAQHVGSMmaAPGMSQQVQGMQSV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14488 with Med25 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TSPQAKTYSPSPTSQERISRNDHLQDMKPVVSNIQQ
304
339










Molecular Recognition Features






MoRF SequenceStartStop




NANANA