<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14469
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MPPSVLVLIIYFKKELRSLNRELQLHILELADILVERPSQYARSVEDISLIFKNLHHLLNSLCPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKDSIGTMEDTGASFVLK |
Length | 117 |
Position | Middle |
Organism | Prunus persica (Peach) (Amygdalus persica) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.176 |
Instability index | 73.09 |
Isoelectric point | 9.25 |
Molecular weight | 13660.86 |
Publications | PubMed=23525075
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14469
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.63| 16| 38| 30| 48| 1
---------------------------------------------------------------------------
30- 48 (22.67/21.15) LADIL...VERPSQyarSVEDI
71- 89 (22.96/12.62) LIHILelqIQRRKQ...AVEDI
---------------------------------------------------------------------------
|