<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14464
| Description |
Uncharacterized protein |
| Sequence | MDAISQLQEKVNTIATIAFTTIGTLQRDAPPVRISPNYPESGSGPAPAAAPNPNPTPTPTPTPIADSDADFAKQPKLMSAELVKAAKQFDALVAALPLSEGGEEAQLKRIAQLEAENDAVGQQLEKQLEAAGDESFHLVTFHTVFNFLQFYDIIDIVDCF |
| Length | 160 |
| Position | Middle |
| Organism | Prunus persica (Peach) (Amygdalus persica) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.164 |
| Instability index | 46.92 |
| Isoelectric point | 4.34 |
| Molecular weight | 17150.07 |
| Publications | PubMed=23525075
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14464
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.74| 13| 14| 36| 49| 1
---------------------------------------------------------------------------
36- 49 (21.66/10.30) PNyPESGSGPAPAA
53- 65 (27.08/ 9.48) PN.PTPTPTPTPIA
---------------------------------------------------------------------------
|