<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14459

Description Uncharacterized protein
SequenceMDGSEIIEAHGSVALEAAPSPLSIVAIAINGNRKSKYIVRWALEKFVPEGNVFFKLIHVRPRITGVPTPMGNLIPLSQVREDVVAAYRKEIEWQASELLLPYKKMCAQKKVQVDVVVIESDDVANAIAEEIAKSAISNLVLGAPSRGMFKRKQKGLSSKISACSPRFCTIYAVSKGKLSSVRASDSESVASIRDDNSDTCSINSSSSYASGSQTDRGSVGSYSHFRSPSLPMQRFQALTTINQTLLSTKTNSNETIHSRCQSQDLEEGKDGMSSCPSNSDVVHTPSQPSSSGSFLTDNRSWTSDQASTSDVVTDYSSESQANINLELEKLRIELRHVKGMYAMAQSETIDASRKINNLNKRRSEEAIRLKEINSMEEKAKVFATQEKEKYEAAKIEAEYMRECVEREVSQRREAEMKAMHDAEEKEKLESVLVGPVQQYQKFMWDEIVTATSSFSEDLRIGMGAYGTVYKCSFHHTTAAVKVLHSKENRQTKQFQQELEILSKIRHPHLLLLLGACPEHSCLVYEYMENGSLEDRLLQKNSTPPIPWFERFRIAWEVASTLIFLHSSKPKPIIHRDLKPANILLDHNLVSKIGDVGLSTMLNLDPSVSSIYNDTGPVGTLSYIDPEYQRTGIISPQSDVYAFGMVILQLLTAKPARALTHLVETAISDRNLMDVLDPKAGVWPMEETRQLAELGLSCAELRRRDRPDLKEQVVPLLERLKMVADKARDSASTVQCRLPPNHFICPILKDVMQEPCVAADGYTYDRKSIETWIQENDKSPMTNLPLPNKNLIPNYTLLSAIMEWKSRGQ
Length808
PositionTail
OrganismPrunus persica (Peach) (Amygdalus persica)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
Aromaticity0.06
Grand average of hydropathy-0.396
Instability index48.90
Isoelectric point6.46
Molecular weight90381.93
Publications
PubMed=23525075

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP14459
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     113.33|      37|      65|     151|     191|       1
---------------------------------------------------------------------------
  151-  188 (53.15/39.24)	RKQKGLSSKISAcSPRFCTIYAVSKGKLSSVRASDSES
  193-  229 (60.18/32.43)	RDDNSDTCSINS.SSSYASGSQTDRGSVGSYSHFRSPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.09|      15|      37|     376|     391|       2
---------------------------------------------------------------------------
  376-  391 (21.46/20.57)	EEKAkVFATQEKEKYE
  415-  429 (26.63/19.73)	EMKA.MHDAEEKEKLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.67|      20|      38|      81|     100|       4
---------------------------------------------------------------------------
   81-  100 (34.29/21.60)	EDVVAAYRKEIEWQA.SELLL
  121-  141 (27.39/15.96)	DDVANAIAEEIAKSAiSNLVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.01|      15|      15|     286|     300|       5
---------------------------------------------------------------------------
  286-  300 (26.11/15.65)	SQPSSSGSFLTDNRS
  303-  317 (24.90/14.60)	SDQASTSDVVTDYSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.72|      20|     715|      60|      79|       6
---------------------------------------------------------------------------
   60-   79 (38.31/23.11)	RPRITGVPTPMGNLIP....LSQV
  777-  800 (31.42/17.75)	KSPMTNLPLPNKNLIPnytlLSAI
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP14459 with Med32 domain of Kingdom Viridiplantae

Unable to open file!